PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Gh_D08G2127
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family MYB
Protein Properties Length: 315aa    MW: 35924 Da    PI: 7.7259
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Gh_D08G2127genomeNAU-NBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding52.89e-171462148
                     TSSS-HHHHHHHHHHHHHTTTT.-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGgg.tWktIartmgkgRtlkqcksrwqkyl 48
                     +g+W++eEd +l+d+++++G+g +W + +++ g++R++k+c++rw++yl
      Gh_D08G2127 14 KGPWSPEEDSKLKDYIEKYGTGgNWIALPHKAGLKRCGKSCRLRWLNYL 62
                     79*********************************************97 PP

2Myb_DNA-binding40.37.4e-1369111246
                      SSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   2 grWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      g +++eEd  + ++++  G++ W+ Ia+ ++ gRt++++k++w++
      Gh_D08G2127  69 GEFSEEEDMVICNLFATIGSR-WSVIAAQLP-GRTDNDIKNYWNT 111
                      78*******************.*********.***********97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129420.48966IPR017930Myb domain
SuperFamilySSF466891.72E-2711109IPR009057Homeodomain-like
SMARTSM007176.2E-131364IPR001005SANT/Myb domain
PfamPF002491.9E-151462IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.602.5E-241569IPR009057Homeodomain-like
CDDcd001671.51E-91662No hitNo description
PROSITE profilePS5129415.61367117IPR017930Myb domain
SMARTSM007174.9E-1267115IPR001005SANT/Myb domain
PfamPF002491.2E-1169111IPR001005SANT/Myb domain
CDDcd001672.09E-870113No hitNo description
Gene3DG3DSA:1.10.10.601.7E-2370117IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 315 aa     Download sequence    Send to blast
MGRAPCCDKA SVKKGPWSPE EDSKLKDYIE KYGTGGNWIA LPHKAGLKRC GKSCRLRWLN  60
YLRPNIKHGE FSEEEDMVIC NLFATIGSRW SVIAAQLPGR TDNDIKNYWN TKLKKKLMAL  120
SSQPQRKPPP LPIPSSHQTI PPSYKDCSSY YYTPSTRSFE GFEPLSTVQS DLLNHNNTFL  180
ATDSSLNHTT PDSFVSYYPV KEKFLMFGSE PSCSSSDGSS HGKEIKQEDV SNFQGFCAPN  240
GYEDNHKFML SYGNRNQWAE KPSGYHGETP LDYDLEDVKR LIDSSSSNNS CNNNNNNHFF  300
IDESKRQEKV MYYYY
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A1e-26141177108B-MYB
Search in ModeBase
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKM0527230.0KM052723.1 Gossypium hirsutum RAX-like transcription factor RAX4 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012476444.10.0PREDICTED: transcription factor RAX2-like
TrEMBLA0A0D2R9B30.0A0A0D2R9B3_G
STRINGPOPTR_0004s22490.11e-134(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM4282646
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G65790.16e-76myb domain protein 68